Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (N-6His)

Source: E. coli. MW :16.5kD. Recombinant Human Cystatin C is produced by our E.coli expression system and the target gene encoding Gly26-Ala146 is expressed with a 6His tag at the N-terminus. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMENLYFQGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NPEPL1 siRNA (Mouse)
CRN2696-01 15 nmol

NPEPL1 siRNA (Mouse)

Ask
View Details
NPEPL1 siRNA (Mouse)
CRN2696-02 30 nmol

NPEPL1 siRNA (Mouse)

Ask
View Details
UBL3 Rabbit pAb
A4028-01 20 µL

UBL3 Rabbit pAb

Ask
View Details
UBL3 Rabbit pAb
A4028-02 1000 μL

UBL3 Rabbit pAb

Ask
View Details
UBL3 Rabbit pAb
A4028-03 100 μL

UBL3 Rabbit pAb

Ask
View Details
UBL3 Rabbit pAb
A4028-04 500 μL

UBL3 Rabbit pAb

Ask
View Details