Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-4/PRDX4 (N-6His)

Source: E.coli. MW :33.8kD. Recombinant Human Peroxiredoxin-4 is produced by our E.coli expression system and the target gene encoding Trp38-Asn271 is expressed with a 6His tag at the N-terminus. Peroxiredoxin-4 (PRDX4) is a member of the AhpC/TSA family. PRDX4 is a cytoplasmic protein and contains one thioredoxin domain. PRDX4 exists in homodimer or heterodimer with PRDX1. PRDX4 reduces hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. In addition, PRDX4 is probably involved in redox regulation of the cell, regulating the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.

Product Specifications

Gene Name

PRDX4

Gene ID

10549

UniProt

Q13162

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (QBEnd/10), Biotin conjugate, 0.1mg/mL
BNCB0640-100 1x 100 µL

CD34 (QBEnd/10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Coa7 Mouse Gene Knockout Kit (CRISPR)
KN503599 1 Kit

Coa7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL
BNC040265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IQGAP3 Polyclonal Antibody
E-AB-66240-01 60 µL

IQGAP3 Polyclonal Antibody

Sign In for Pricing
View Details
IQGAP3 Polyclonal Antibody
E-AB-66240-02 120 µL

IQGAP3 Polyclonal Antibody

Sign In for Pricing
View Details
IQGAP3 Polyclonal Antibody
E-AB-66240-03 200 µL

IQGAP3 Polyclonal Antibody

Sign In for Pricing
View Details