Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-4/PRDX4 (N-6His)

Source: E.coli. MW :33.8kD. Recombinant Human Peroxiredoxin-4 is produced by our E.coli expression system and the target gene encoding Trp38-Asn271 is expressed with a 6His tag at the N-terminus. Peroxiredoxin-4 (PRDX4) is a member of the AhpC/TSA family. PRDX4 is a cytoplasmic protein and contains one thioredoxin domain. PRDX4 exists in homodimer or heterodimer with PRDX1. PRDX4 reduces hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. In addition, PRDX4 is probably involved in redox regulation of the cell, regulating the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.

Product Specifications

Gene Name

PRDX4

Gene ID

10549

UniProt

Q13162

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Vmn1r175 shRNA (UAS) - Lentiviral mouse Vmn1r175 shRNA (UAS, iRFP) (100)
GTR15217035 1 Vial

Lentiviral mouse Vmn1r175 shRNA (UAS) - Lentiviral mouse Vmn1r175 shRNA (UAS, iRFP) (100)

Ask
View Details
Silver Nitrate 10%
40120422-1 500 mL

Silver Nitrate 10%

Ask
View Details
CIDE B (CIDEB) Rabbit Polyclonal Antibody
TA330407 100 µL

CIDE B (CIDEB) Rabbit Polyclonal Antibody

Ask
View Details
G2E3 Rabbit pAb (APR20960N)
APR20960N-01 50 µL

G2E3 Rabbit pAb (APR20960N)

Ask
View Details
G2E3 Rabbit pAb (APR20960N)
APR20960N-02 100 µL

G2E3 Rabbit pAb (APR20960N)

Ask
View Details
G2E3 Rabbit pAb (APR20960N)
APR20960N-03 200 µL

G2E3 Rabbit pAb (APR20960N)

Ask
View Details