Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-2/ARG2 (C-6His)

Source: E.coli. MW :34.2kD. Recombinant Human Arginase-2, mitochondrial is produced by our E.coli expression system and the target gene encoding His24-Gly330 is expressed with a 6His tag at the C-terminus. Arginase-2 (ARG2) is a member of the arginase family. Arginase is a manganese-containing enzyme which catalyzes the hydrolysis of arginine to ornithine and urea. ARG2 is highly expressed in kidney and prostate, not founded in the liver, heart and pancreas. ARG2 has been implicated in the regulation of the arginine/ornithine concentrations in the cell. ARG2 may take part in the regulation of extra-urea cycle arginine metabolism and in down-regulation of nitric oxide synthesis. The extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase.

Product Specifications

Gene Name

ARG2

Gene ID

384

UniProt

P78540

Components

Supplied as a 0.2 μm filtered solution of 10mM TrisHCl,10mM NaCl,1mM beta-mercaptoethanol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRL Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-43099R-BF680 100 µL

PRL Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details
TNFRSF10D
553286 100 µL

TNFRSF10D

Ask
View Details
Lentiviral mouse Nipsnap2 shRNA (UAS) - Lentiviral mouse Nipsnap2 shRNA (UAS, GFP) (100)
GTR15214905 1 Vial

Lentiviral mouse Nipsnap2 shRNA (UAS) - Lentiviral mouse Nipsnap2 shRNA (UAS, GFP) (100)

Ask
View Details
Peropsin Rabbit Polyclonal Antibody
E53P05551 100 µL

Peropsin Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Tolloid Like Protein 1 (TLL1)
MBS2124692-01 0.01 mg

Recombinant Tolloid Like Protein 1 (TLL1)

Ask
View Details
Recombinant Tolloid Like Protein 1 (TLL1)
MBS2124692-02 0.05 mg

Recombinant Tolloid Like Protein 1 (TLL1)

Ask
View Details