Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-2/ARG2 (C-6His)

Source: E.coli. MW :34.2kD. Recombinant Human Arginase-2, mitochondrial is produced by our E.coli expression system and the target gene encoding His24-Gly330 is expressed with a 6His tag at the C-terminus. Arginase-2 (ARG2) is a member of the arginase family. Arginase is a manganese-containing enzyme which catalyzes the hydrolysis of arginine to ornithine and urea. ARG2 is highly expressed in kidney and prostate, not founded in the liver, heart and pancreas. ARG2 has been implicated in the regulation of the arginine/ornithine concentrations in the cell. ARG2 may take part in the regulation of extra-urea cycle arginine metabolism and in down-regulation of nitric oxide synthesis. The extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase.

Product Specifications

Gene Name

ARG2

Gene ID

384

UniProt

P78540

Components

Supplied as a 0.2 μm filtered solution of 10mM TrisHCl,10mM NaCl,1mM beta-mercaptoethanol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tissue Genomic DNA, Breast
CD563871 5 µg

Tissue Genomic DNA, Breast

Ask
View Details
Cabp7 (NM_138948) Mouse Tagged ORF Clone
MR225000 10 µg

Cabp7 (NM_138948) Mouse Tagged ORF Clone

Ask
View Details
Rabbit Polyclonal Histone H3 Antibody
NB500-171 0.1 mL

Rabbit Polyclonal Histone H3 Antibody

Ask
View Details
WNT10A Protein Vector (Rat) (pPM-C-HA)
50444026 500 ng

WNT10A Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
SCARA5 AAV Vector (Rat) (CMV)
43099106 1 µg

SCARA5 AAV Vector (Rat) (CMV)

Ask
View Details
A, a-Azo Iso Butyronitrile (AIBN, 2,2-Azo Bis [2-2, Methyl Propionitrile] for synthesis
013595-01 100 g

A, a-Azo Iso Butyronitrile (AIBN, 2,2-Azo Bis [2-2, Methyl Propionitrile] for synthesis

Ask
View Details