Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc Finger Protein 70/ZNF70 (N-6His)

Source: E.coli. MW :53kD. Recombinant Human Zinc Finger Protein 70 is produced by our E.coli expression system and the target gene encoding Met1-Leu446 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 70 (ZNF70) is a member of the krueppel C2H2-type zinc-finger protein family. ZFN70 is localized to the cell nucleus and contains eleven C2H2-type zinc fingers. ZFN70 has sequence-specific DNA binding transcription factor activity, and it may be involved in transcriptional regulation. In addition, ZFN70 has the DNA-binding and metal-binding activity, which can bind zinc ion.

Product Specifications

Gene Name

ZNF70

Gene ID

7621

UniProt

Q9UC06

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal CHORDC1 Antibody [Alexa Fluor 488]
NBP1-78304AF488 0.1 mL

Rabbit Polyclonal CHORDC1 Antibody [Alexa Fluor 488]

Ask
View Details
Anti-Phospho-LCK-(Y394) antibody
STJ22226 100 µl

Anti-Phospho-LCK-(Y394) antibody

Ask
View Details
1- (3-Bromophenyl) -2,2-dimethylpropan-1-one
OR1038526 100 mg

1- (3-Bromophenyl) -2,2-dimethylpropan-1-one

Ask
View Details
Human Semaphorin 3F (S3F) ELISA Kit
MBS2805010-01 48 Tests

Human Semaphorin 3F (S3F) ELISA Kit

Ask
View Details
Human Semaphorin 3F (S3F) ELISA Kit
MBS2805010-02 96 Tests

Human Semaphorin 3F (S3F) ELISA Kit

Ask
View Details
Human Semaphorin 3F (S3F) ELISA Kit
MBS2805010-03 5x 96 Tests

Human Semaphorin 3F (S3F) ELISA Kit

Ask
View Details