Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High Mobility Group Protein B1/HMGB1

Source: E. coli. MW :10.5kD. Recombinant Human High Mobility Group Protein B1 is produced by our E.coli expression system and the target gene encoding Gly2-Phe89 is expressed. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Product Specifications

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Lyophilized from a 0.2 μm filtered solution of 50mMHepes,500mMNaCl,0.5mMDTT, pH7.9 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human METTL17 Knockout A549 cell line
GTR15407391 1 Vial

Human METTL17 Knockout A549 cell line

Ask
View Details
RXRG Protein Lysate (Mouse) with C-HA Tag
42916034 100 µg

RXRG Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: OTI3G1]
CF800771 100 µg

Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: OTI3G1]

Ask
View Details
SLC2A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44107111 3x 1.0 µg

SLC2A9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
Lentiviral mouse Slc15a3 shRNA (UAS) - Lentiviral mouse Slc15a3 shRNA (UAS, RFP) (100)
GTR15212100 1 Vial

Lentiviral mouse Slc15a3 shRNA (UAS) - Lentiviral mouse Slc15a3 shRNA (UAS, RFP) (100)

Ask
View Details
MIRacle™ rno-miR-29a-5p miRNA Agomir/Antagomir
AM5107 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-29a-5p miRNA Agomir/Antagomir

Ask
View Details