Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High Mobility Group Protein B1/HMGB1

Source: E. coli. MW :10.5kD. Recombinant Human High Mobility Group Protein B1 is produced by our E.coli expression system and the target gene encoding Gly2-Phe89 is expressed. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Product Specifications

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Lyophilized from a 0.2 μm filtered solution of 50mMHepes,500mMNaCl,0.5mMDTT, pH7.9 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFYC, NT (NFYC, Nuclear transcription factor Y subunit gamma, CAAT box DNA-binding protein subunit C, Nuclear transcription factor Y subunit C, Transactivator HSM-1/2) (MaxLight 650) discontinued
038951-ML650 100 µL

NFYC, NT (NFYC, Nuclear transcription factor Y subunit gamma, CAAT box DNA-binding protein subunit C, Nuclear transcription factor Y subunit C, Transactivator HSM-1/2) (MaxLight 650) discontinued

Ask
View Details
Mouse TECK/CCL25 (Thymus Expressed Chemokine) ValidElisa Kit
EK343243 96 Well

Mouse TECK/CCL25 (Thymus Expressed Chemokine) ValidElisa Kit

Ask
View Details
CNBD1 Human shRNA Lentiviral Particle (Locus ID 168975)
TL305336V 500 µL Each

CNBD1 Human shRNA Lentiviral Particle (Locus ID 168975)

Ask
View Details
Mouse Galnt14 Pre-designed siRNA Set A
SI105245A 1 Each

Mouse Galnt14 Pre-designed siRNA Set A

Ask
View Details