Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High Mobility Group Protein B1/HMGB1

Source: E. coli. MW :10.5kD. Recombinant Human High Mobility Group Protein B1 is produced by our E.coli expression system and the target gene encoding Gly2-Phe89 is expressed. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Product Specifications

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Lyophilized from a 0.2 μm filtered solution of 50mMHepes,500mMNaCl,0.5mMDTT, pH7.9 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NOTCH4 (Neurogenic Locus Notch Homolog Protein 4, Notch 4, hNotch4, INT3) (MaxLight 405) discontinued
N5375-51H-ML405 100 µL

NOTCH4 (Neurogenic Locus Notch Homolog Protein 4, Notch 4, hNotch4, INT3) (MaxLight 405) discontinued

Ask
View Details
CORIO CD-600F Refrig Circulator
BAT8103 1 Each

CORIO CD-600F Refrig Circulator

Ask
View Details
Anti-Carbonic Anhydrase 9 (Rabbit, Polyclonal)
A102985 100 µL

Anti-Carbonic Anhydrase 9 (Rabbit, Polyclonal)

Ask
View Details
RMND5B Polyclonal Antibody
E-AB-18705-01 20 µL

RMND5B Polyclonal Antibody

Ask
View Details
RMND5B Polyclonal Antibody
E-AB-18705-02 60 μL

RMND5B Polyclonal Antibody

Ask
View Details
RMND5B Polyclonal Antibody
E-AB-18705-03 120 μL

RMND5B Polyclonal Antibody

Ask
View Details