Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His

Source: E.coli. MW :15.1kD. Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.

Product Specifications

Gene Name

EIF4EBP2

Gene ID

1979

UniProt

Q13542

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epiandrosterone
orb341615-01 1 ml x 10 mM (in DMSO)

Epiandrosterone

Sign In for Pricing
View Details
Epiandrosterone
orb341615-02 1 g

Epiandrosterone

Sign In for Pricing
View Details
Altenuene
TN3401 1 mg

Altenuene

Sign In for Pricing
View Details
Recombinant Mouse S100A9 Protein, N-His
E55P8003 50 µg

Recombinant Mouse S100A9 Protein, N-His

Sign In for Pricing
View Details
Pregnancy Associated Plasma Protein A (PAPP-A, Pappalysin 1, PAPA, PAPPA, PAPP-A, PAPPA1, Aspecific BCL2 ARE-binding Protein 2, ASBABP2, Differentially Placenta 1 Expressed Protein, DIPLA1, EC 3.4.24.79, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, Pappalysin 1 Precursor) (APC) discontinued
P6000-88-APC 100 µL

Pregnancy Associated Plasma Protein A (PAPP-A, Pappalysin 1, PAPA, PAPPA, PAPP-A, PAPPA1, Aspecific BCL2 ARE-binding Protein 2, ASBABP2, Differentially Placenta 1 Expressed Protein, DIPLA1, EC 3.4.24.79, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, Pappalysin 1 Precursor) (APC) discontinued

Sign In for Pricing
View Details
RACK1 Antibody
orb2807863 100 µL

RACK1 Antibody

Sign In for Pricing
View Details