Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His

Source: E.coli. MW :15.1kD. Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.

Product Specifications

Gene Name

EIF4EBP2

Gene ID

1979

UniProt

Q13542

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Calpastatin antibody
PAab01220 100 µg

Anti-Calpastatin antibody

Ask
View Details
K562-CAR1-GPRC5D Overexpressing Cell Line
RG-1423 5x 10^6

K562-CAR1-GPRC5D Overexpressing Cell Line

Ask
View Details
C1D Nuclear Receptor co-repressor
308563 100 µL

C1D Nuclear Receptor co-repressor

Ask
View Details
Lentiviral mouse Sult2a8 shRNA (UAS) - Lentiviral mouse Sult2a8 shRNA (UAS, iRFP) plasmid
GTR15189256 1 Vial

Lentiviral mouse Sult2a8 shRNA (UAS) - Lentiviral mouse Sult2a8 shRNA (UAS, iRFP) plasmid

Ask
View Details
Rabbit Polyclonal RNF139 Antibody
NBP1-59756 100 µL

Rabbit Polyclonal RNF139 Antibody

Ask
View Details
Rat Adiponectin Receptor 2 (ADIPOR2) ELISA Kit
MBS454116-01 48 Tests

Rat Adiponectin Receptor 2 (ADIPOR2) ELISA Kit

Ask
View Details