Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His

Source: E.coli. MW :15.1kD. Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.

Product Specifications

Gene Name

EIF4EBP2

Gene ID

1979

UniProt

Q13542

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL4 Rabbit pAb, PE-Cy7 conjugated
orb2890493 100 µL

MRPL4 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Lentiviral human COPS7B shRNA (UAS) - Lentiviral human COPS7B shRNA (UAS) plasmid
GTR15114955 1 Vial

Lentiviral human COPS7B shRNA (UAS) - Lentiviral human COPS7B shRNA (UAS) plasmid

Sign In for Pricing
View Details
NOSIP Double Nickase Plasmid (m)
sc-425991-NIC 20 µg

NOSIP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
EZM0414 1mg
A23996-1 1 mg

EZM0414 1mg

Sign In for Pricing
View Details
Mouse Laminin subunit alpha-5 ELISA Kit
EK3453 Inquire

Mouse Laminin subunit alpha-5 ELISA Kit

Sign In for Pricing
View Details
LRP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1231007 1.0 µg DNA

LRP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details