Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc Finger Protein 75A/ZNF75A (N-6His)

Source: E.coli. MW :14.33kD. Recombinant Human Zinc Finger Protein 75A is produced by our E.coli expression system and the target gene encoding Ser58-Lys162 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 75A (ZNF75A) is a member of krueppel C2H2-type zinc-finger protein family. The human ZNF75 gene is located on Xq26, which has only limited homology (less than 65%) to other ZF genes in the databases. One of these, ZNF75B is a pseudogene mapped to chromosome 12q13. The other two, ZNF75A and ZNF75C, maintain an ORF in the sequenced region, and at least the latter is expressed in the U937 cell line. ZNF75A contains five C2H2-type zinc fingers and one KRAB domain. ZNF75A is a nucleus protein, may involves in transcriptional regulation.

Product Specifications

Gene Name

ZNF75A

Gene ID

7627

UniProt

Q96N20

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAP-2 Polyclonal Antibody
JOT-AP05205-01 50ul

MAP-2 Polyclonal Antibody

Ask
View Details
MAP-2 Polyclonal Antibody
JOT-AP05205-02 100ul

MAP-2 Polyclonal Antibody

Ask
View Details
CDK4 Monoclonal Antibody
A10420-100UL 100 µL

CDK4 Monoclonal Antibody

Ask
View Details
AdmiRa-mmu-miR-7678-5p Virus
mm2074 250 µL

AdmiRa-mmu-miR-7678-5p Virus

Ask
View Details
5-Aminotricyclo[3.3.1.13,7]decane-1,3-diol
TRC-A633195-5MG 5 mg

5-Aminotricyclo[3.3.1.13,7]decane-1,3-diol

Ask
View Details
Eukaryotic Translation Initiation Factor 5 (EIF5) Antibody
abx109286-01 20 µg

Eukaryotic Translation Initiation Factor 5 (EIF5) Antibody

Ask
View Details