Recombinant Human Bridging Integrator 2/BIN2/BRAP1 (N-6His)

Source: E.coli. MW :30.58kD. Recombinant Human Bridging Integrator 2 is produced by our E.coli expression system and the target gene encoding Met1-Asn244 is expressed with a 6His tag at the N-terminus. Bridging Integrator 2 (BIN2) is a cytoplasmic protein. BIN2 contains one BAR domain and Interacts with BIN1. BIN2 is highly expressed in some hematopoietic tissues, including peripheral blood, thymus, colon and placenta. BIN2 is an Arabidopsis GSK3-like kinase that negatively regulates brassinosteroid (BR) signaling. Genetic studies show that BIN2 is inhibited in response to BR perception at the cell surface to relieve its inhibitory effects on downstream targets.

Product Specifications

Gene Name

BIN2

Gene ID

51411

UniProt

Q9UBW5

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSN