Recombinant Human Calcineurin Subunit B1/CNB1 (N-6His)

Source: E.coli. MW :21.46kD. Recombinant Human Calcineurin Subunit B1 is produced by our E.coli expression system and the target gene encoding Met1-Val170 is expressed with a 6His tag at the N-terminus. Calcineurin Subunit B Type 1 belongs to the calcineurin regulatory subunit family. Calcineurin Subunit B Type 1 is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase. It is composed of a catalytic subunit (A) and a regulatory subunit (B) . It contains four EF-hand domains and four functional calcium-binding sites. Calcineurin Subunit B Type 1 plays an improtant role in the T cell activation pathway.

Product Specifications

Gene Name

PPP3R1

Gene ID

5534

UniProt

P63098

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, pH 8.0 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV