Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WW Domain-Binding Protein 1/WBP1 (N-6His)

Source: E.coli. MW :12.6kD. Recombinant Human WW Domain-Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Gly170-Pro269 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 1 (WBP1) is widely expressed in many tissues, but it is lowly expressed in the lung, placenta, kidney, and liver. WBP1 contains two WW-binding motifs: WW-binding 1 and WW-binding 2 that are involved in mediating protein-protein interactions through the binding of polyproline ligands. The WW-binding domain is composed of 38 to 40 semi-conserved amino acids shared by proteins with diverse functions including structural, regulatory, and signaling proteins. In addition, WBP1 also encodes a ligand of the WW domain of the Yes kinase-associated protein. This function has not been determined.

Product Specifications

Gene Name

WBP1

Gene ID

23559

UniProt

Q96G27

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal NrCAM Antibody (S364-51)
NBP2-42191-0.025mg 0.025 mg

Mouse Monoclonal NrCAM Antibody (S364-51)

Ask
View Details
Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit
ELK9477-01 48 Tests

Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit

Ask
View Details
Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit
ELK9477-02 96 Tests

Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit

Ask
View Details
Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit
ELK9477-03 5x 96 Tests

Human SGPL1 (Sphingosine 1 Phosphate Lyase 1) ELISA Kit

Ask
View Details
Diosgenin glucoside
MBS579820 Inquire

Diosgenin glucoside

Ask
View Details
Anti-CD1D antibody
STJ22977 100 µl

Anti-CD1D antibody

Ask
View Details