Recombinant Human WW Domain-Binding Protein 1/WBP1 (N-6His)
Source: E.coli. MW :12.6kD. Recombinant Human WW Domain-Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Gly170-Pro269 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 1 (WBP1) is widely expressed in many tissues, but it is lowly expressed in the lung, placenta, kidney, and liver. WBP1 contains two WW-binding motifs: WW-binding 1 and WW-binding 2 that are involved in mediating protein-protein interactions through the binding of polyproline ligands. The WW-binding domain is composed of 38 to 40 semi-conserved amino acids shared by proteins with diverse functions including structural, regulatory, and signaling proteins. In addition, WBP1 also encodes a ligand of the WW domain of the Yes kinase-associated protein. This function has not been determined.
Product Specifications
Gene Name
WBP1
Gene ID
23559
UniProt
Q96G27
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGSSHHHHHHSSGLVPRGSHMGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items