Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth Factor Receptor-Bound Protein 2/GRB2/ASH (C-6His)

Source: E.coli. MW :26.3kD. Recombinant Human GRB2 is produced by our E.coli expression system and the target gene encoding Met1-Val217 is expressed with a 6His tag at the C-terminus. As an adaptor protein, Growth Factor Receptor-Bound Protein 2 (GRB2) is involved in siganl transduction and consists of a central SH2 domain flanked by two SH3 domains. GRB2 associates with activated Tyr-phosphorylated EGF receptor/EGFR and PDGF receptors via its SH2 domain, stimulating GTP binding to Ras, which in turn activates MAPK and other signaling pathway.It also associates to other cellular Tyr-phosphorylated proteins such as SIT1, IRS1, IRS4, SHC and LNK. probably via the concerted action of both its SH2 and SH3 domains.

Product Specifications

Gene Name

GRB2

Gene ID

2885

UniProt

P62993

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNVLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Synaptophysin (SYP) ELISA Kit
MBS4502715-01 48 Tests

Mouse Synaptophysin (SYP) ELISA Kit

Ask
View Details
Mouse Synaptophysin (SYP) ELISA Kit
MBS4502715-02 96 Tests

Mouse Synaptophysin (SYP) ELISA Kit

Ask
View Details
Mouse Synaptophysin (SYP) ELISA Kit
MBS4502715-03 5x 96 Tests

Mouse Synaptophysin (SYP) ELISA Kit

Ask
View Details
Mouse Synaptophysin (SYP) ELISA Kit
MBS4502715-04 10x 96 Tests

Mouse Synaptophysin (SYP) ELISA Kit

Ask
View Details
TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 650)
MBS6356908-01 0.1 mL

TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 650)

Ask
View Details
TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 650)
MBS6356908-02 5x 0.1 mL

TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (MaxLight 650)

Ask
View Details