Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycine N-Methyltransferase/GNMT (N-6His)

Source: E.coli. MW :34.9kD. Recombinant Human GNMT is produced by our E.coli expression system and the target gene encoding Met1-Asg294 is expressed with a 6His tag at the N-terminus. Glycine N-Methyltransferase (GNMT) is a tetrameric cytosolic protein. GNMT catalyzes the synthesis of N-methylglycine from glycine using S-adenosylmethionine (AdoMet) as the methyl donor. It can affects DNA methylation by regulating the ratio of S-adenosylmethionine to S-adenosylhomocystine, playing an important role in maintaining normal AdoMet levels. GNMT is highly expressed in liver. As a major folate-binding protein, GNMT takes part in the detoxification pathway. Defects in GNMT are the cause of hypermethioninemia. the patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases.

Product Specifications

Gene Name

GNMT

Gene ID

27232

UniProt

Q14749

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (MaxLight 750) discontinued
226860-ML750 100 µL

CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (MaxLight 750) discontinued

Ask
View Details
Rabbit anti-lNTl Antibody, Affinity Purified
A300-361A 100 µg

Rabbit anti-lNTl Antibody, Affinity Purified

Ask
View Details
HAX1 cDNA Clone
MBS1267045-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

HAX1 cDNA Clone

Ask
View Details
HAX1 cDNA Clone
MBS1267045-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

HAX1 cDNA Clone

Ask
View Details
ROMO1 (NM_080748) Human Tagged Lenti ORF Clone
RC210655L1 10 µg

ROMO1 (NM_080748) Human Tagged Lenti ORF Clone

Ask
View Details
Human IGSF11 Knockout HEK293T cell line
GTR15407050 1 Vial

Human IGSF11 Knockout HEK293T cell line

Ask
View Details