Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycine N-Methyltransferase/GNMT (N-6His)

Source: E.coli. MW :34.9kD. Recombinant Human GNMT is produced by our E.coli expression system and the target gene encoding Met1-Asg294 is expressed with a 6His tag at the N-terminus. Glycine N-Methyltransferase (GNMT) is a tetrameric cytosolic protein. GNMT catalyzes the synthesis of N-methylglycine from glycine using S-adenosylmethionine (AdoMet) as the methyl donor. It can affects DNA methylation by regulating the ratio of S-adenosylmethionine to S-adenosylhomocystine, playing an important role in maintaining normal AdoMet levels. GNMT is highly expressed in liver. As a major folate-binding protein, GNMT takes part in the detoxification pathway. Defects in GNMT are the cause of hypermethioninemia. the patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases.

Product Specifications

Gene Name

GNMT

Gene ID

27232

UniProt

Q14749

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GST M5-5, Recombinant Human
MBS480632-01 0.1 mg

GST M5-5, Recombinant Human

Ask
View Details
GST M5-5, Recombinant Human
MBS480632-02 5x 0.1 mg

GST M5-5, Recombinant Human

Ask
View Details
TIM-1 (T-Cell Immunoglobin Mucin-1, KIM1, TIM1, TIMD1, HAVCR1) (Biotin)
MBS6249363-01 0.1 mL

TIM-1 (T-Cell Immunoglobin Mucin-1, KIM1, TIM1, TIMD1, HAVCR1) (Biotin)

Ask
View Details
TIM-1 (T-Cell Immunoglobin Mucin-1, KIM1, TIM1, TIMD1, HAVCR1) (Biotin)
MBS6249363-02 5x 0.1 mL

TIM-1 (T-Cell Immunoglobin Mucin-1, KIM1, TIM1, TIMD1, HAVCR1) (Biotin)

Ask
View Details
Beta-actin Antibody
MBS8584290-01 0.1 mL

Beta-actin Antibody

Ask
View Details
Beta-actin Antibody
MBS8584290-02 0.1 mL (AF635)

Beta-actin Antibody

Ask
View Details