Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2 (N-GST)

Source: E.coli. MW :37.96kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2 is produced by our E.coli expression system and the target gene encoding Glu124-Arg224 is expressed with a GST tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 J2 (UBE2J2) belongs to the ubiquitin-conjugating enzyme family. UBE2J2 is involved in the ubiquitiantion. UBE2J2 located in the membrane of the endoplasmic reticulum, catalyzes the covalent attachment of ubiquitin to other proteins. UBE2J2 may play a important role in the selective degradation of misfolded membrane protein from the endoplasmic reticulum.

Product Specifications

Gene Name

UBE2J2

Gene ID

118424

UniProt

Q8N2K1

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit
MBS7619006-01 48 Well

Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit

Ask
View Details
Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit
MBS7619006-02 96 Well

Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit

Ask
View Details
Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit
MBS7619006-03 5x 96 Well

Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit

Ask
View Details
Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit
MBS7619006-04 10x 96 Well

Human PSCA (Prostate stem cell antigen) QuickTest ELISA Kit

Ask
View Details
MIRA DNA Isothermal Rapid Amplification Kit (Nucleic Acid Test Strip)
WLN8203KIT 48 Tests/Box

MIRA DNA Isothermal Rapid Amplification Kit (Nucleic Acid Test Strip)

Ask
View Details
KRTAP27-1 Recombinant Protein Antigen
NBP1-91071PEP 0.1 mL

KRTAP27-1 Recombinant Protein Antigen

Ask
View Details