Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like-conjugating Enzyme ATG3/ATG3

Source: E.coli. MW :36kD. Recombinant Human Ubiquitin-like-conjugating Enzyme ATG3 is produced by our E.coli expression system and the target gene encoding Met1-Met314 is expressed. Ubiquitin-like-conjugating enzyme ATG3 (ATG3), also known as Apg3L and Apg3p, functions as a regulatory component of autophagosome biogenesis necessary for autophagy. ATG3 exhibits 98% aa sequence identity with both its mouse and rat orthologs. It is widely expressed and has highly levels in heart, skeletal muscle, kidney, liver and placenta. As an E2-like enzyme, involves in autophagy and mitochondrial homeostasis. ATG3 catalyzes the conjugation of ATG8-like proteins to PE which is essential for autophagy. ATG3 also can catalyze the conjugation of ATG12 to itself which palys a role in mitochondrial homeostasis but not in autophagy.

Product Specifications

Gene Name

ATG3

Gene ID

64422

UniProt

Q9NT62

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details
Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details
Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details
Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details
Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details
Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)
MBS1479253-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Tagatose-6-phosphate kinase (lacC)

Ask
View Details