Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Partner of Y14 and Mago/WIBG /PYM (C-6His)

Source: E.coli. MW :23.7kD. Recombinant Human Partner of Y14 and Mago is produced by our E.coli expression system and the target gene encoding Met1-Leu204 is expressed with a 6His tag at the C-terminus. Partner of Y14 and Mago (WIBG) is a key regulator of the Exon Junction Complex (EJC) . EJC is a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs, is a positional landmarker for the intron exon structure of genes, and directs post-transcriptional processes in the cytoplasm, for instance mRNA export, nonsense-mediated mRNA decay or translation. WIBG is a cytoplasmic RNA-binding protein, it can be excluded from nucleus by Crm1. WIBG as a cooperateing partner of Mago-14, relates with Mago-14 by its N-terminal domain.

Product Specifications

Gene Name

PYM1

Gene ID

84305

UniProt

Q9BRP8

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGLLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit
MBS9913391-01 48 Well

Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit
MBS9913391-02 96 Well

Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit
MBS9913391-03 5x 96 Well

Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit
MBS9913391-04 10x 96 Well

Rat Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit

Sign In for Pricing
View Details
VK2/E6E7 Cells
116305L 0.5 mg

VK2/E6E7 Cells

Sign In for Pricing
View Details
Rat Dnttip1 Pre-designed siRNA Set A
SI203971A 1 Each

Rat Dnttip1 Pre-designed siRNA Set A

Sign In for Pricing
View Details