Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Partner of Y14 and Mago/WIBG /PYM (C-6His)

Source: E.coli. MW :23.7kD. Recombinant Human Partner of Y14 and Mago is produced by our E.coli expression system and the target gene encoding Met1-Leu204 is expressed with a 6His tag at the C-terminus. Partner of Y14 and Mago (WIBG) is a key regulator of the Exon Junction Complex (EJC) . EJC is a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs, is a positional landmarker for the intron exon structure of genes, and directs post-transcriptional processes in the cytoplasm, for instance mRNA export, nonsense-mediated mRNA decay or translation. WIBG is a cytoplasmic RNA-binding protein, it can be excluded from nucleus by Crm1. WIBG as a cooperateing partner of Mago-14, relates with Mago-14 by its N-terminal domain.

Product Specifications

Gene Name

PYM1

Gene ID

84305

UniProt

Q9BRP8

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGLLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcap29 (NM_007530) Mouse Untagged Clone
MC218077 10 µg

Bcap29 (NM_007530) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1363052-01 0.02 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1363052-02 0.1 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1363052-03 0.02 mg (Baculovirus)

Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1363052-04 0.02 mg (Mammalian-Cell)

Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1363052-05 1 mg (E-Coli)

Recombinant Rhodoferax ferrireducens Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details