Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc Finger Protein 100/ZNF100 (N-6His)

Source: E.coli. MW :15kD. Recombinant Human Zinc Finger Protein 100 is produced by our E.coli expression system and the target gene encoding Met1-Lys109 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 100 (ZNF100) is part of the krueppel C2H2-type zinc-finger protein family. ZNF100 contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 is a DNA-binding protein domain consisting of zinc fingers. Zinc finger protein 100 occurs in nature as the part of transcription factors conferring DNA sequence specificity as the DNA-binding domain. Zinc finger proteins have also found use in protein engineering due to their modularity and have prospects as components of tools for use in therapeutic gene modulation and zinc finger nucleases.

Product Specifications

Gene Name

ZNF100

Gene ID

163227

UniProt

Q8IYN0

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, 1mM ZnCl2, 30% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMRHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD70 (NM_001252) Human Tagged Lenti ORF Clone
RC200410L3 10 µg

CD70 (NM_001252) Human Tagged Lenti ORF Clone

Ask
View Details
Bovine Apolipoprotein A-I-binding protein, APOA1BP ELISA KIT
ELI-24783b 96 Tests

Bovine Apolipoprotein A-I-binding protein, APOA1BP ELISA KIT

Ask
View Details
Hadhb Mouse Gene Knockout Kit (CRISPR)
KN507553 1 Kit

Hadhb Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Recombinant Escherichia coli Uncharacterized protein yadK (yadK)
MBS1246778-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein yadK (yadK)

Ask
View Details
Recombinant Escherichia coli Uncharacterized protein yadK (yadK)
MBS1246778-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein yadK (yadK)

Ask
View Details
Recombinant Escherichia coli Uncharacterized protein yadK (yadK)
MBS1246778-03 0.02 mg (Yeast)

Recombinant Escherichia coli Uncharacterized protein yadK (yadK)

Ask
View Details