Recombinant Human Neurturin
Source: E.coli. MW :11.8kD. Recombinant Human Neurturin is produced by our E.coli expression system and the target gene encoding Ala96-Val197 is expressed. Neurturin is a member of the GDNF family of ligands, which include glial cell-derived neurotrophic factor (GDNF), Neurturin, Persephin, and Artemin. Neurturin is expressed in both neuronal and nonneuronal tissues. Similarly to other TGF beta family proteins, Neurturin is synthesized as a precursor protein that is cleaved at the dibasic cleavage site (RXXR) to release the carboxyterminal domain. The carboxy terminal domain of Neurturin contains the characteristic seven conserved cysteine residues necessary for the formation of the cysteine-knot and the single interchain disulfide bond. Biologically active human Neurturin is a disulfide-linked homodimer of the carboxy-terminal 102 amino acid residues. Unlike other members of TGF- beta family, bioactivities of all GDNF family ligands are mediated through a unique multicomponent receptor complex composed of high affinity ligand binding component (GFRa-1-GFRa-4) and a common signaling component (cRET receptor tyrosine kinase) . Each member of the GDNF family ligands has its preferred binding protein. Neurturin preferentially binds to GFRa-2 but can also bind GFRa-1 at higher concentrations. It may play a role in regulating the development and maintenance of the central and peripheral nervous systems and as well as non neuronal systems.
Product Specifications
Gene Name
NRTN
Gene ID
4902
UniProt
Q99748
Components
Lyophilized from a 0.2 μm filtered solution of 10mM sodium citrate, pH4.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
GSARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items