Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurturin

Source: E.coli. MW :11.8kD. Recombinant Human Neurturin is produced by our E.coli expression system and the target gene encoding Ala96-Val197 is expressed. Neurturin is a member of the GDNF family of ligands, which include glial cell-derived neurotrophic factor (GDNF), Neurturin, Persephin, and Artemin. Neurturin is expressed in both neuronal and nonneuronal tissues. Similarly to other TGF beta family proteins, Neurturin is synthesized as a precursor protein that is cleaved at the dibasic cleavage site (RXXR) to release the carboxyterminal domain. The carboxy terminal domain of Neurturin contains the characteristic seven conserved cysteine residues necessary for the formation of the cysteine-knot and the single interchain disulfide bond. Biologically active human Neurturin is a disulfide-linked homodimer of the carboxy-terminal 102 amino acid residues. Unlike other members of TGF- beta family, bioactivities of all GDNF family ligands are mediated through a unique multicomponent receptor complex composed of high affinity ligand binding component (GFRa-1-GFRa-4) and a common signaling component (cRET receptor tyrosine kinase) . Each member of the GDNF family ligands has its preferred binding protein. Neurturin preferentially binds to GFRa-2 but can also bind GFRa-1 at higher concentrations. It may play a role in regulating the development and maintenance of the central and peripheral nervous systems and as well as non neuronal systems.

Product Specifications

Gene Name

NRTN

Gene ID

4902

UniProt

Q99748

Components

Lyophilized from a 0.2 μm filtered solution of 10mM sodium citrate, pH4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR3B Antibody
E94889 100 µg

ACTR3B Antibody

Sign In for Pricing
View Details
EphB4 Active Recombinant Protein N-His & GST Tag 50ug
IEPHB4ARNHISGST50UG 50 µg

EphB4 Active Recombinant Protein N-His & GST Tag 50ug

Sign In for Pricing
View Details
Recombinant Human AMN Protein, His, E.coli-5ug
QP11013-5ug 5ug

Recombinant Human AMN Protein, His, E.coli-5ug

Sign In for Pricing
View Details
Rat Dock3 Pre-designed siRNA Set A
SI203979A 1 Each

Rat Dock3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
a-Tocopherol (Vitamin E), Conjugated
MBS612102-01 0.1 mL

a-Tocopherol (Vitamin E), Conjugated

Sign In for Pricing
View Details
a-Tocopherol (Vitamin E), Conjugated
MBS612102-02 5x 0.1 mL

a-Tocopherol (Vitamin E), Conjugated

Sign In for Pricing
View Details