Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Source: E.coli. MW :22.5kD. Recombinant Human Inosine Triphosphate Pyrophosphatase is produced by our E.coli expression system and the target gene encoding Ala2-Ala194 is expressed with a 6His tag at the C-terminus. Inosine Triphosphate Pyrophosphatase (ITPase) is a cytoplasmic enzyme that belongs to the HAM1 NTPase family. ITPase hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP) and deoxyinosine triphosphate (dITP) to the monophosphate nucleotide (IMP) and diphosphate. The ITPase enzyme acts as a homodimer and does not distinguish between the deoxy- and ribose forms. ITPase probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions. Defects in ITPase is thought to be inherited and is characterized by an over-accumulation of ITP in erythocytes, leukocytes and fibroblasts.

Product Specifications

Gene Name

ITPA

Gene ID

3704

UniProt

Q9BY32

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAALEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Autoimmune Regulator (AIRE) Guinea Pig ELISA Kit
B3541 96 Tests

Autoimmune Regulator (AIRE) Guinea Pig ELISA Kit

Ask
View Details
Lentiviral human BNC1 shRNA (UAS) - Lentiviral human BNC1 shRNA (UAS) (100)
GTR15145842 1 Vial

Lentiviral human BNC1 shRNA (UAS) - Lentiviral human BNC1 shRNA (UAS) (100)

Ask
View Details
ZDHHC20 siRNA (h)
sc-76954 10 µM

ZDHHC20 siRNA (h)

Ask
View Details
BTG4 (NM_017589) Human Tagged Lenti ORF Clone
RC214339L4 10 µg

BTG4 (NM_017589) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral human COPB1 shRNA (UAS) - Lentiviral human COPB1 shRNA (UAS, GFP) (100)
GTR15095313 1 Vial

Lentiviral human COPB1 shRNA (UAS) - Lentiviral human COPB1 shRNA (UAS, GFP) (100)

Ask
View Details