Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WW Domain-Binding Protein 2/WBP2 (N-6His)

Source: E.coli. MW :13.38kD. Recombinant Human WW Domain-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ala100 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 2 (WBP2) is a ubiquitous protein that contains one GRAM domain. The WW domain is composed of 38 to 40 semi-conserved AA shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is participated in mediating protein-protein interactions. WBP2 binds to the WW domain of YAP1, WWP1 and WWP2. The WW-binding 1 motif of WBP2 mediates interaction with NEDD4. The function of this protein WBP2 has not been determined. Some researches demonstrate that WBP-2 also interacts with the thyroid-specific transcription factor Pax8.

Product Specifications

Gene Name

WBP2

Gene ID

23558

UniProt

Q969T9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Beta Catenin (S33 + S37) Recombinant Rabbit Monoclonal Antibody [JE59-59]
HA721580 100 µL

Phospho-Beta Catenin (S33 + S37) Recombinant Rabbit Monoclonal Antibody [JE59-59]

Sign In for Pricing
View Details
MATER Rabbit Polyclonal Antibody
ER50101 100 µL

MATER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitin D (UBD) (NM_006398) Human Over-expression Lysate
LY401929 100 µg

Ubiquitin D (UBD) (NM_006398) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SQSTM1/p62 Monoclonal Antibody
E-AB-81512-01 50 µL

Recombinant SQSTM1/p62 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SQSTM1/p62 Monoclonal Antibody
E-AB-81512-02 100 µL

Recombinant SQSTM1/p62 Monoclonal Antibody

Sign In for Pricing
View Details
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: 1A11]
AM09004PU-N 100 µL

Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: 1A11]

Sign In for Pricing
View Details