Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WW Domain-Binding Protein 2/WBP2 (N-6His)

Source: E.coli. MW :13.38kD. Recombinant Human WW Domain-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ala100 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 2 (WBP2) is a ubiquitous protein that contains one GRAM domain. The WW domain is composed of 38 to 40 semi-conserved AA shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is participated in mediating protein-protein interactions. WBP2 binds to the WW domain of YAP1, WWP1 and WWP2. The WW-binding 1 motif of WBP2 mediates interaction with NEDD4. The function of this protein WBP2 has not been determined. Some researches demonstrate that WBP-2 also interacts with the thyroid-specific transcription factor Pax8.

Product Specifications

Gene Name

WBP2

Gene ID

23558

UniProt

Q969T9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cellufine MAX Q-h
20603 10 L

Cellufine MAX Q-h

Ask
View Details
28S ribosomal protein S22 mitochondrial (MRPS22) Mouse ELISA Kit
B0473 96 Tests

28S ribosomal protein S22 mitochondrial (MRPS22) Mouse ELISA Kit

Ask
View Details
Human DLK2/EGFL9 MAb (Clone 908866R)
MAB97561-SP 25 µg

Human DLK2/EGFL9 MAb (Clone 908866R)

Ask
View Details
Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit
MBS7232737-01 48 Well

Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit

Ask
View Details
Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit
MBS7232737-02 96 Well

Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit

Ask
View Details
Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit
MBS7232737-03 5x 96 Well

Rat Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit

Ask
View Details