Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Superoxide Dismutase [Cu-Zn]/SOD1/Cu-Zn SOD (N-6His)

Source: E.coli. MW :18.1kD. Recombinant Human SOD1 is produced by our E.coli expression system and the target gene encoding Met1-Gln154 is expressed with a 6His tag at the N-terminus. Superoxide Dismutase [Cu-Zn] (SOD1) is a soluble cytoplasmic and mitochondrial intermembrane space protein that belongs to the Cu-Zn superoxide dismutase family. SOD1 binds copper and zinc ions and is one of three isozymes responsible for destroying free superoxide radicals in the body. SOD1 neutralizes supercharged oxygen molecules, which can damage cells if their levels are not controlled. The enzyme protects the cell against dangerous levels of superoxide. Zinc binding promotes dimerization and stabilizes the native form. Mutations in SOD1 cause a form of familial amyotrophic lateral sclerosis. Defects in SOD1 are the cause of amyotrophic lateral sclerosis type 1 (ALS1) which is a familial form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis.

Product Specifications

Gene Name

SOD1

Gene ID

6647

UniProt

P00441

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAF1 antibody (Ser301)
70R-15054 100 ul

RAF1 antibody (Ser301)

Ask
View Details
ZFYVE9 Antibody
A38686-100UL 100 µL

ZFYVE9 Antibody

Ask
View Details
GPR87/GPR95 Blocking Peptide
MBS9625147-01 1 mg

GPR87/GPR95 Blocking Peptide

Ask
View Details
GPR87/GPR95 Blocking Peptide
MBS9625147-02 5x 1 mg

GPR87/GPR95 Blocking Peptide

Ask
View Details
Research Grade Anti-Human DLK1 (CBA-1205)
DHF71401 100 μg

Research Grade Anti-Human DLK1 (CBA-1205)

Ask
View Details
Progesterone Receptor (PgR) (BSA & Azide Free) (Formerly P9007-04X) (MaxLight 650) discontinued
P9007-12X-ML650 100 µL

Progesterone Receptor (PgR) (BSA & Azide Free) (Formerly P9007-04X) (MaxLight 650) discontinued

Ask
View Details