Recombinant Human Amyloid beta A4 Precursor Protein-Binding A3/APBA3/X11-gamma (C-6His)
Source: E.coli. MW :15.48kD. Recombinant Human APBA3 is produced by our E.coli expression system and the target gene encoding Met1-Leu138 is expressed with a 6His tag at the C-terminus. Amyloid beta A4 Precursor Protein-Binding Family A Member 3 (APBA3) is an adapter protein that belongs to the X11 family. APBA3 contains 2 PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein.. APBA3 is believed to be involved in signal transduction processes. Unlike X11-a and - beta which are generally neuronal proteins, APBA3 is widely expressed in all tissues examined with lower levels in brain and testis. It binds to the cytoplasmic domain of amyloid protein (APP) in vivo and may modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Product Specifications
Gene Name
APBA3
Gene ID
9546
UniProt
O96018
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB ,150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLLEHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items