Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 4/CLIC4 (N-6His)

Source: E.coli. MW :30.9kD. Recombinant Human CLIC4 is produced by our E.coli expression system and the target gene encoding Met1-Lys253 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 4 (CLIC4) is a 253 amino acid single-pass membrane protein that localizes to both the nucleus and the cytoplasm and contains one GST C-terminal domain. CLIC4 is expressed in various tissues and exhibits an intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells) . CLIC4 acts as a monomer which is able to form selective ion channels in target proteins, thus facilitating the transport of chloride and other ions. CLIC4 is believed to have a role in apoptosis and is able to translocate to the nucleus under stress conditions. CLIC4 has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis.

Product Specifications

Gene Name

CLIC4

Gene ID

25932

UniProt

Q9Y696

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

XPG (Xeroderma Pigmentosum Type G, ERCC5, ERCM2, Excision Repair Cross Complementing Rodent Repair Deficiency, UVDR, Xeroderma Pigmentosum Complementation Group G, XPGC, DNA Repair Protein Complementing XP-G Cells, DNA Excision Repair Protein ERCC-5) (Biotin) discontinued
X1048-01A-Biotin 100 µL

XPG (Xeroderma Pigmentosum Type G, ERCC5, ERCM2, Excision Repair Cross Complementing Rodent Repair Deficiency, UVDR, Xeroderma Pigmentosum Complementation Group G, XPGC, DNA Repair Protein Complementing XP-G Cells, DNA Excision Repair Protein ERCC-5) (Biotin) discontinued

Ask
View Details
Anti-TBR2 / Eomes  (1D5)
YF-MA16337 100 ug

Anti-TBR2 / Eomes (1D5)

Ask
View Details
(R) -2-Amino-3- (furan-2-yl) propanoic acid 250mg
A23368-250 250 mg

(R) -2-Amino-3- (furan-2-yl) propanoic acid 250mg

Ask
View Details
INSR antibody
20R-IR025 50 ug

INSR antibody

Ask
View Details
Mouse Jph4 Pre-designed siRNA Set B
SI106952B 1 Each

Mouse Jph4 Pre-designed siRNA Set B

Ask
View Details
Rabbit anti-PMS2 Recombinant Monoclonal Antibody [BLR142H]
MBS3906444-01 0.02 mL

Rabbit anti-PMS2 Recombinant Monoclonal Antibody [BLR142H]

Ask
View Details