Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 4/CLIC4 (N-6His)

Source: E.coli. MW :30.9kD. Recombinant Human CLIC4 is produced by our E.coli expression system and the target gene encoding Met1-Lys253 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 4 (CLIC4) is a 253 amino acid single-pass membrane protein that localizes to both the nucleus and the cytoplasm and contains one GST C-terminal domain. CLIC4 is expressed in various tissues and exhibits an intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells) . CLIC4 acts as a monomer which is able to form selective ion channels in target proteins, thus facilitating the transport of chloride and other ions. CLIC4 is believed to have a role in apoptosis and is able to translocate to the nucleus under stress conditions. CLIC4 has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis.

Product Specifications

Gene Name

CLIC4

Gene ID

25932

UniProt

Q9Y696

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CMRF35-like molecule 5, Clm5 ELISA KIT
ELI-25815m 96 Tests

Mouse CMRF35-like molecule 5, Clm5 ELISA KIT

Ask
View Details
RILPL1 (NM_178314) Human Over-expression Lysate
LH00724V 100 µg

RILPL1 (NM_178314) Human Over-expression Lysate

Ask
View Details
Rabbit Polyclonal Bcl G Antibody
NBP1-91697 0.1 mL

Rabbit Polyclonal Bcl G Antibody

Ask
View Details
CA095 Rabbit Polyclonal Antibody
BT-AP00954-01 20 µL

CA095 Rabbit Polyclonal Antibody

Ask
View Details
CA095 Rabbit Polyclonal Antibody
BT-AP00954-02 50 µL

CA095 Rabbit Polyclonal Antibody

Ask
View Details
CA095 Rabbit Polyclonal Antibody
BT-AP00954-03 100 µL

CA095 Rabbit Polyclonal Antibody

Ask
View Details