Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prefoldin Subunit 4/PFDN4 (N-6His)

Source: E.coli. MW :17.48kD. Recombinant Human Prefoldin Subunit 4 is produced by our E.coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 4 (PFDN4) is a heterohexameric chaperone protein that belongs to the prefoldin subunit beta family. The complex of PFDN4, consisting of two PFD-alpha type and four PFD-beta type subunits, forms a double beta barrel assembly with six protruding coiled-coils. PFDN4 binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly.

Product Specifications

Gene Name

PFDN4

Gene ID

5203

UniProt

Q9NQP4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme K Recombinant Rabbit monoclonal Antibody
HA723826 100 µL

Granzyme K Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Bap1 Mouse Gene Knockout Kit (CRISPR)
KN501976 1 Kit

Bap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H6]
TA502940BM 100 µL

STAT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H6]

Sign In for Pricing
View Details
LysoViewTM 594, 1000X in DMSO, Trial Size
#70084-T 1x 10 µL

LysoViewTM 594, 1000X in DMSO, Trial Size

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL
BNC470775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kv1.8 (KCNA10) (NM_005549) Human Over-expression Lysate
LC401703 20 µg

Kv1.8 (KCNA10) (NM_005549) Human Over-expression Lysate

Sign In for Pricing
View Details