Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prefoldin Subunit 4/PFDN4 (N-6His)

Source: E.coli. MW :17.48kD. Recombinant Human Prefoldin Subunit 4 is produced by our E.coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 4 (PFDN4) is a heterohexameric chaperone protein that belongs to the prefoldin subunit beta family. The complex of PFDN4, consisting of two PFD-alpha type and four PFD-beta type subunits, forms a double beta barrel assembly with six protruding coiled-coils. PFDN4 binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly.

Product Specifications

Gene Name

PFDN4

Gene ID

5203

UniProt

Q9NQP4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS802326 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
FASTK Rabbit Polyclonal Antibody
AP20588PU-N 100 µg

FASTK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Taf9 Mouse Gene Knockout Kit (CRISPR)
KN517156 1 Kit

Taf9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL
BNC881880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCAT1 (NM_001178092) Human Over-expression Lysate
LY432891 100 µg

BCAT1 (NM_001178092) Human Over-expression Lysate

Sign In for Pricing
View Details
BTG1 Mouse Monoclonal Antibody [Clone ID: OTI7H6]
CF807834 100 µg

BTG1 Mouse Monoclonal Antibody [Clone ID: OTI7H6]

Sign In for Pricing
View Details