Recombinant Human Prefoldin Subunit 4/PFDN4 (N-6His)

Source: E.coli. MW :17.48kD. Recombinant Human Prefoldin Subunit 4 is produced by our E.coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 4 (PFDN4) is a heterohexameric chaperone protein that belongs to the prefoldin subunit beta family. The complex of PFDN4, consisting of two PFD-alpha type and four PFD-beta type subunits, forms a double beta barrel assembly with six protruding coiled-coils. PFDN4 binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly.

Product Specifications

Gene Name

PFDN4

Gene ID

5203

UniProt

Q9NQP4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES