Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelial Differentiation-Related Factor 1/EDF1/MBF1 (C-6His)

Source: E.coli. MW :17.4kD. Recombinant Human EDF1 is produced by our E.coli expression system and the target gene encoding Ala2-Lys148 is expressed with a 6His tag at the C-terminus. Endothelial Differentiation-Related Factor 1 (EDF1) is a 148 amino acid transcriptional coactivator that contains 1 HTH cro/C1-type DNA-binding domain. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. When endothelial cells are induced to differentiate in vitro, EDF1 is downregulated, leading to inhibition of cell growth and cell polarization. EDF1 binds calmodulin thorough its IQ domain and regulates nitric oxide synthase activity through calmodulin sequestration in the cytoplasm. Though ubiquitously expressed, EDF1 is most abundant in adult liver, heart, adipose tissues, intestine and pancreas. In fetal tissues, EDF1 is most abundant in kidney. There are two isoforms of EDF1 that are produced as a result of alternative splicing events.

Product Specifications

Gene Name

EDF1

Gene ID

8721

UniProt

O60869

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD68 Monoclonal Antibody
MBS9700356-01 0.03 mL

CD68 Monoclonal Antibody

Ask
View Details
CD68 Monoclonal Antibody
MBS9700356-02 0.1 mL

CD68 Monoclonal Antibody

Ask
View Details
CD68 Monoclonal Antibody
MBS9700356-03 0.2 mL

CD68 Monoclonal Antibody

Ask
View Details
CD68 Monoclonal Antibody
MBS9700356-04 5x 0.2 mL

CD68 Monoclonal Antibody

Ask
View Details
SEC22B Rabbit Polyclonal Antibody
APRab17691-01 20 µL

SEC22B Rabbit Polyclonal Antibody

Ask
View Details
SEC22B Rabbit Polyclonal Antibody
APRab17691-02 50 µL

SEC22B Rabbit Polyclonal Antibody

Ask
View Details