Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Estrogen Receptor a/ERa/NR3A1 (N-6His)

Source: E.coli. MW :14.38kD. Recombinant Human Estrogen receptor alpha is produced by our E.coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus. Estrogen Receptor is a major ligand-activated transcription factor belonging to the nuclear hormone receptor superfamily. Estrogen Receptor is composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but they also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.

Product Specifications

Gene Name

ESR1

Gene ID

2099

UniProt

P03372

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Kif26a shRNA (UAS) - Lentiviral mouse Kif26a shRNA (UAS) plasmid
GTR15206323 1 Vial

Lentiviral mouse Kif26a shRNA (UAS) - Lentiviral mouse Kif26a shRNA (UAS) plasmid

Ask
View Details
FKBP5
enz-939 2µg

FKBP5

Ask
View Details
Recombinant Human Renin receptor (ATP6AP2)
CSB-EP002384HU-01 20 µg

Recombinant Human Renin receptor (ATP6AP2)

Ask
View Details
Recombinant Human Renin receptor (ATP6AP2)
CSB-EP002384HU-02 100 µg

Recombinant Human Renin receptor (ATP6AP2)

Ask
View Details
Recombinant Human Renin receptor (ATP6AP2)
CSB-EP002384HU-03 1 mg

Recombinant Human Renin receptor (ATP6AP2)

Ask
View Details