Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His)

Source: E.coli. MW :34kD. Recombinant Human PITPNA is produced by our E.coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus. Phosphatidylinositol Transfer Protein a Isoform (PITPNA) is found in the cytoplasm and belongs to the PtdIns transfer protein family. PITPNA is a ubiquitous and highly conserved protein in multicellular eukaryotes that catalyzes the exchange of phospholipids between membranes and participates in cellular phospholipid metabolism, signal transduction and vesicular trafficking in vivo. It is expressed in a wide range of tissues and implicated in phospholipase C signaling and in the production of phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) by phosphoinositide-3-kinase.

Product Specifications

Gene Name

PITPNA

Gene ID

5306

UniProt

Q00169

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM EDTA, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit
MBS9344498-01 48 Well

Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit

Ask
View Details
Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit
MBS9344498-02 96 Well

Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit

Ask
View Details
Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit
MBS9344498-03 5x 96 Well

Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit

Ask
View Details
Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit
MBS9344498-04 10x 96 Well

Porcine Tryptase Alpha/Beta-1 (TPSAB1) ELISA Kit

Ask
View Details
Total Antioxidant (T-AOC) Capacity Assay Kit
E47S350 50 Tests - 48 Samples

Total Antioxidant (T-AOC) Capacity Assay Kit

Ask
View Details
Anti-LY75/CD205/DEC-205 Reference Antibody (CDX-1401)
MBS9247414-01 0.1 mg

Anti-LY75/CD205/DEC-205 Reference Antibody (CDX-1401)

Ask
View Details