Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutamine Synthetase/GLUL (C-6His)

Source: E.coli. MW :43.13kD. Recombinant Human Glutamine Synthetase is produced by our E.coli expression system and the target gene encoding Thr2-Asn373 is expressed with a 6His tag at the C-terminus. Glutamine Synthetase reglutes intracellular concentration of glutamate. Glutamine Synthetase catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is an important source of energy and that takes part in cell prolifetation, inhibition of apoptosis, and cell signaling. Glutamine Synthetase is expressed during early fetal stages, and has a role in maintaining body PH by removing ammonia from circulation. Mutations in the GLUL gene are related to congenital glutamine deficiency.

Product Specifications

Gene Name

GLUL

Gene ID

2752

UniProt

P15104

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKNLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RMI2 shRNA (UAS) - Lentiviral human RMI2 shRNA (UAS, iRFP) (25)
GTR15330173 1 Vial

Lentiviral human RMI2 shRNA (UAS) - Lentiviral human RMI2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD25 Antibody (YA4670, Mouse)
HY-P84978 1 Each

CD25 Antibody (YA4670, Mouse)

Sign In for Pricing
View Details
DNAJC5B (NM_033105) Human Tagged ORF Clone Lentiviral Particle
RC205251L4V 200 µL

DNAJC5B (NM_033105) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Nf1 Pre-designed siRNA Set A
SI109288A 1 Each

Mouse Nf1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
[1',2',3',4',5'-13C5]thymidine
sc-287283A 100 mg

[1',2',3',4',5'-13C5]thymidine

Sign In for Pricing
View Details
Anti-Laminin gamma 1  (M1)
YF-MA13956 100 ug

Anti-Laminin gamma 1 (M1)

Sign In for Pricing
View Details