Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutamine Synthetase/GLUL (C-6His)

Source: E.coli. MW :43.13kD. Recombinant Human Glutamine Synthetase is produced by our E.coli expression system and the target gene encoding Thr2-Asn373 is expressed with a 6His tag at the C-terminus. Glutamine Synthetase reglutes intracellular concentration of glutamate. Glutamine Synthetase catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is an important source of energy and that takes part in cell prolifetation, inhibition of apoptosis, and cell signaling. Glutamine Synthetase is expressed during early fetal stages, and has a role in maintaining body PH by removing ammonia from circulation. Mutations in the GLUL gene are related to congenital glutamine deficiency.

Product Specifications

Gene Name

GLUL

Gene ID

2752

UniProt

P15104

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKNLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TJAP1 Rabbit Polyclonal Antibody
TA356262 100 µL

TJAP1 Rabbit Polyclonal Antibody

Ask
View Details
Rabbit Anti-Human GOPC pAb
PA7056-01 50 μL

Rabbit Anti-Human GOPC pAb

Ask
View Details
Rabbit Anti-Human GOPC pAb
PA7056-02 100 μL

Rabbit Anti-Human GOPC pAb

Ask
View Details
APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)
MBS2110375-01 0.1 mL

APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)

Ask
View Details
APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)
MBS2110375-02 0.2 mL

APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)

Ask
View Details
APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)
MBS2110375-03 0.5 mL

APC-Linked Monoclonal Antibody to Doublecortin Like Kinase 1 (DCLK1)

Ask
View Details