Recombinant Human Interleukin-8/IL-8 (C-6His)
Source: Human Cells. MW :10.1kD. Recombinant Human C-X-C motif chemokine 8 is produced by our Mammalian expression system and the target gene encoding Glu21-Ser99 is expressed with a 6His tag at the C-terminus. Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.
Product Specifications
Gene Name
CXCL8
Gene ID
3576
UniProt
P10145
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items