Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8/IL-8 (C-6His)

Source: Human Cells. MW :10.1kD. Recombinant Human C-X-C motif chemokine 8 is produced by our Mammalian expression system and the target gene encoding Glu21-Ser99 is expressed with a 6His tag at the C-terminus. Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.

Product Specifications

Gene Name

CXCL8

Gene ID

3576

UniProt

P10145

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Heart Total Protein
HT-801 0.5 mg

Human Heart Total Protein

Ask
View Details
DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (FITC) discontinued
034716-FITC 200 µL

DNAJC24, ID (DNAJC24, DPH4, ZCSL3, DnaJ homolog subfamily C member 24, CSL-type zinc finger-containing protein 3, DPH4 homolog) (FITC) discontinued

Ask
View Details