Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Creatine Kinase, Muscle/CKMM (C-6His)

Source: Human Cells. MW :44.1kD. Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus. Creatine kinase M-type is also known as Creatine kinase M chain, M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family, containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Product Specifications

Gene Name

CKM

Gene ID

1158

UniProt

P06732

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD9 Protein Vector (Mouse) (pPM-C-HA)
PV214976 500 ng

PDZD9 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Mouse Tnfrsf9 Protein, C-rFc-tagged
IMP-1583 100 µg

Recombinant Mouse Tnfrsf9 Protein, C-rFc-tagged

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) CCAMK Polyclonal Antibody
MBS7196871 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) CCAMK Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Defa26 shRNA (UAS) - Lentiviral mouse Defa26 shRNA (UAS, iRFP) plasmid
GTR15198376 1 Vial

Lentiviral mouse Defa26 shRNA (UAS) - Lentiviral mouse Defa26 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rab27a Recombinant Antibody, PE Conjugated
bsm-62025R-PE-01 20 µL

Rab27a Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Rab27a Recombinant Antibody, PE Conjugated
bsm-62025R-PE-02 100 µL

Rab27a Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details