Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Creatine Kinase, Muscle/CKMM (C-6His)

Source: Human Cells. MW :44.1kD. Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus. Creatine kinase M-type is also known as Creatine kinase M chain, M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family, containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Product Specifications

Gene Name

CKM

Gene ID

1158

UniProt

P06732

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Histone H3 [ac Lys9 ac Lys14] Antibody
NBP2-54617 50 µg

Rabbit Polyclonal Histone H3 [ac Lys9 ac Lys14] Antibody

Ask
View Details
COX 1, Ovine std (not enzymatically active) (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker)
MBS653655-01 0.01 mg

COX 1, Ovine std (not enzymatically active) (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker)

Ask
View Details
COX 1, Ovine std (not enzymatically active) (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker)
MBS653655-02 5x 0.01 mg

COX 1, Ovine std (not enzymatically active) (Cyclooxygenase-1, PGHS-1, Prostaglandin Endoperoxide Synthase-1, PHS 1, Ovarian Cancer Marker)

Ask
View Details
INS Polyclonal Antibody
MBS2572300-01 0.025 mL

INS Polyclonal Antibody

Ask
View Details
INS Polyclonal Antibody
MBS2572300-02 0.1 mL

INS Polyclonal Antibody

Ask
View Details
INS Polyclonal Antibody
MBS2572300-03 5x 0.1 mL

INS Polyclonal Antibody

Ask
View Details