Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin 3A2/BTN3A2 (C-6His)

Source: Human Cells. MW :24.6kD. Recombinant Human Butyrophilin 3A2 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. Butyrophilin subfamily 3 member A2, also known as BT3.2, BTF3, BTF4 and BTN3A2, is a single-pass type I membrane protein. It is a member of the butyrophilin (BTN) family and the immunoglobulin (IG) superfamily. BTN3A2 plays a role in T-cell responses in the adaptive immune response and inhibits the release of IFNG from activated T-cells.

Product Specifications

Gene Name

BTN3A2

Gene ID

11118

UniProt

P78410

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal RYBP/DEDAF Antibody [Allophycocyanin]
NBP3-21428APC 0.1 mL

Rabbit Polyclonal RYBP/DEDAF Antibody [Allophycocyanin]

Ask
View Details
OTTMUSG00000010552 (m) -PR
sc-151604-PR 10 µM - 20 µL

OTTMUSG00000010552 (m) -PR

Ask
View Details
PATJ (INADL, InaD-like Protein, Inadl Protein, hINADL)
MBS642012-01 0.05 mg

PATJ (INADL, InaD-like Protein, Inadl Protein, hINADL)

Ask
View Details
PATJ (INADL, InaD-like Protein, Inadl Protein, hINADL)
MBS642012-02 5x 0.05 mg

PATJ (INADL, InaD-like Protein, Inadl Protein, hINADL)

Ask
View Details
Recombinant A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2031738-01 0.01 mg

Recombinant A Disintegrin And Metalloprotease 8 (ADAM8)

Ask
View Details
Recombinant A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2031738-02 0.05 mg

Recombinant A Disintegrin And Metalloprotease 8 (ADAM8)

Ask
View Details