Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13/IL-13 (C-6His)

Source: Human Cells. MW :14.3kD. Recombinant Human Interleukin-13 is produced by our Mammalian expression system and the target gene encoding Leu25-Asn146 is expressed with a 6His tag at the C-terminus. Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.

Product Specifications

Gene Name

IL13

Gene ID

3596

UniProt

P35225

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IOLILYTE LBE 01 (456) 0-33
LBE-01 (456) 0-33-HP-0100 100 g

IOLILYTE LBE 01 (456) 0-33

Ask
View Details
Lentiviral human TRMO shRNA (UAS) - Lentiviral human TRMO shRNA (UAS, RFP) (100)
GTR15111840 1 Vial

Lentiviral human TRMO shRNA (UAS) - Lentiviral human TRMO shRNA (UAS, RFP) (100)

Ask
View Details
Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)
MBS7032416-01 0.02 mg

Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)

Ask
View Details
Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)
MBS7032416-02 0.1 mg

Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)

Ask
View Details
Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)
MBS7032416-03 5x 0.1 mg

Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23 (TVP23)

Ask
View Details
A-673
ARC0036 1 Million

A-673

Ask
View Details