Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon omega -1/IFNW1 (C-6His)

Source: Human Cells. MW :21.1kD. Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 is expressed with a 6His tag at the C-terminus. Interferon omega-1 is also known as Interferon alpha-II-1and IFNW1. It is a Secreted protein that in humans is encoded by the IFNW1 gene. IFNW1 belongs to the alpha/beta interferon family. Type I IFNs consist of IFN a, beta, t, and g and bind to the type I IFN receptor, whereas IFN-a is the only type II IFN and is specific for the type II IFN receptor. IFNW1 is a recently discovered protein structurally related to IFN-alpha and –beta. It has been shown that IFN-omega 1 similar to that of other human class I IFNs; potent antiviral activity was also observed on cells of bovine and ovine but not of equine or murine origin.

Product Specifications

Gene Name

IFNW1

Gene ID

3467

UniProt

P05000

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Discoidin Domain Receptor Family, Member 1 (DDR1) BioAssayTM ELISA Kit (Mouse) discontinued
024690-01 48 Tests

Discoidin Domain Receptor Family, Member 1 (DDR1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Discoidin Domain Receptor Family, Member 1 (DDR1) BioAssayTM ELISA Kit (Mouse) discontinued
024690-02 96 Tests

Discoidin Domain Receptor Family, Member 1 (DDR1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
RT1-M5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV650905 1.0 µg DNA

RT1-M5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PALM2
MBS8562676-01 0.2 mL

PALM2

Sign In for Pricing
View Details
PALM2
MBS8562676-02 0.1 mL (AF405L)

PALM2

Sign In for Pricing
View Details
PALM2
MBS8562676-03 0.1 mL (AF405S)

PALM2

Sign In for Pricing
View Details