Recombinant Human Limbic System-Associated Membrane Protein/LSAMP (C-6His)

Source: Human Cells. MW :32.8kD. Recombinant Human LSAMP is produced by our Mammalian expression system and the target gene encoding Val29-Asn315 is expressed with a 6His tag at the C-terminus. Limbic system-associated membrane protein is also known as LSAMP, IgLON family member 3. In humans, it is encoded by the LSAMP gene. It belongs to the immunoglobulin superfamily and contains 3 Ig-like C2-type domains. Limbic system-associated membrane protein mediates selective neuronal growth and axon targeting. It contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. It is also essential for normal growth of the hyppocampal mossy fiber projection

Product Specifications

Gene Name

LSAMP

Gene ID

4045

UniProt

Q13449

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINVDHHHHHH