Recombinant Human Vasoactive Intestinal Peptide/VIP (C-6His)
Source: Human Cells. MW :15.9kD. Recombinant Human Vasoactive intestinal peptide is produced by our Mammalian expression system and the target gene encoding Ser21-Gly152 is expressed with a 6His tag at the C-terminus. Vasoactive intestinal peptide is also known as the vasoactive intestinal polypeptide or VIP. In humans, it is encoded by the VIP gene. VIP is neuropeptide which belongs to a glucagon/secretin superfamily, the ligand of class II G protein-coupled receptors. VIP is produced in many tissues of vertebrates including the gut, pancreas and suprachiasmatic nuclei of the hypothalamus in the brain. VIP stimulates contractility in the heart, causes vasodilation, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. VIP has a half-life in the blood of about two minutes.
Product Specifications
Gene Name
VIP
Gene ID
7432
UniProt
P01282
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items