Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasoactive Intestinal Peptide/VIP (C-6His)

Source: Human Cells. MW :15.9kD. Recombinant Human Vasoactive intestinal peptide is produced by our Mammalian expression system and the target gene encoding Ser21-Gly152 is expressed with a 6His tag at the C-terminus. Vasoactive intestinal peptide is also known as the vasoactive intestinal polypeptide or VIP. In humans, it is encoded by the VIP gene. VIP is neuropeptide which belongs to a glucagon/secretin superfamily, the ligand of class II G protein-coupled receptors. VIP is produced in many tissues of vertebrates including the gut, pancreas and suprachiasmatic nuclei of the hypothalamus in the brain. VIP stimulates contractility in the heart, causes vasodilation, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. VIP has a half-life in the blood of about two minutes.

Product Specifications

Gene Name

VIP

Gene ID

7432

UniProt

P01282

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Polyclonal VSV-G Epitope Tag Antibody [CoraFluor 1]
NB100-2484CL1 0.1 mL

Goat Polyclonal VSV-G Epitope Tag Antibody [CoraFluor 1]

Ask
View Details
Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2025770-01 0.1 mL

Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2025770-02 0.2 mL

Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2025770-03 0.5 mL

Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2025770-04 1 mL

Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2025770-05 5 mL

Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details