Recombinant Human Regenerating Islet-Derived Protein 3-gamma /Reg3 gamma /REG3G (C-6His)

Source: Human Cells. MW :17.5kD. Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus. Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, is a secreted protein which contains 1 C-type lectin domain. It is expressed almost exclusively in the pancreas and also expressed in testis, but not found in small intestine. This protein might be a stress protein involved in the control of bacterial proliferation.

Product Specifications

Gene Name

REG3G

Gene ID

130120

UniProt

Q6UW15

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDVDHHHHHH