Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-II/ApoA2 (C-6His)

Source: Human Cells. MW :9.74kD. Recombinant Human Apolipoprotein A-II is produced by our Mammalian expression system and the target gene encoding Gln24-Gln100 is expressed with a 6His tag at the C-terminus. Apolipoprotein A-II (Apo-AII for short), also known as Apolipoprotein A2, is a secreted protein which belongs to the apolipoprotein A2 family. It exists as a disulfide-linked homodimer; and also can form a disulfide-linked heterodimer with APOD. APOA2 is the 2nd most abundant protein of the high density lipoprotein particles. This protein may stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Defects in APOA2 gene might cause apolipoprotein A-II deficiency or hypercholesterolemia.

Product Specifications

Gene Name

APOA2

Gene ID

336

UniProt

P02652

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal DOG1/TMEM16A Antibody (DG1/1486) [Alexa Fluor 647]
NBP2-54484AF647 100 µL

Mouse Monoclonal DOG1/TMEM16A Antibody (DG1/1486) [Alexa Fluor 647]

Ask
View Details
Human CARD17P Pre-designed siRNA Set A
SI002185A 1 Each

Human CARD17P Pre-designed siRNA Set A

Ask
View Details
Cynomolgus Monkey Uterus Frozen Section
NHFF-1123-HX737 Each

Cynomolgus Monkey Uterus Frozen Section

Ask
View Details
Recombinant Human MAPK11
P0202-01 50 µg

Recombinant Human MAPK11

Ask
View Details
Recombinant Human MAPK11
P0202-02 200 µg

Recombinant Human MAPK11

Ask
View Details
Recombinant Human MAPK11
P0202-03 1 mg

Recombinant Human MAPK11

Ask
View Details